missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PTCH1 (Human) Recombinant Protein
Human PTCH1 partial ORF (NP_000255.2, 651 a.a. - 750 a.a.) recombinant protein with GST tag at N-terminal.
Marca: Abnova™ H00005727-Q02.10ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
- Sequence: AHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAK
Specifica
| NP_000255.2 | |
| patched homolog 1 (Drosophila) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PTCH1 | |
| GST |
| 5727 | |
| Wheat germ expression system | |
| 10 μg | |
| BCNS, FLJ26746, FLJ42602, HPE7, NBCCS, PTC, PTC1, PTCH, PTCH11 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |