missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ RAD51C Recombinant Protein
Marca: Abnova™ H00005889-P01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
AAH00667.1 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
40.48 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL | |
MGC104277/RAD51L2 | |
RAD51C | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
5889 | |
RAD51C (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
RAD51C | |
Human | |
Recombinant | |
Solution |