missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant HIV-1 gp41 Long Protein

enQuireBio™ Recombinant HIV-1 gp41 Long Protein

Codice prodotto. p-7150108
Click to view available options
Quantità:
1 mg
100 μg
500 μg
Dimensione della confezione:
100µg
1mg
500µg
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 15959828

Marca: enQuireBio™ QP12250EC100ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A cDNA sequence encoding the HIV-1 gp41 Long was constructed and used to recombinantly synthesize the protein.

Specifica

Nome HIV-1 gp41 Long Protein
Quantità 100 μg
Status giuridico Research Use Only
Concentrazione di endotossine Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type Recombinant Protein
Cross-reattività HIV
Specie E. coli
Tag proteine Untagged
Sequenza IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
Tampone 8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Purity or Quality Grade Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato