missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SGTA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
337.00€ - 750.00€
Specifica
| Antigene | SGTA |
|---|---|
| Applicazioni | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Specie ospite | Rabbit |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18183788
|
Novus Biologicals
NBP2-47279 |
0.1 mL |
750.00€
0.10mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18645645
|
Novus Biologicals
NBP2-47279-25ul |
25 μL |
337.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
SGTA Polyclonal specifically detects SGTA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifica
| SGTA | |
| Polyclonal | |
| Rabbit | |
| Human | |
| alphaSGT, Alpha-SGT, protein containing three tetratricopeptide repeats, SGT1, SGThSGT, small glutamine-rich tetratricopeptide repeat (TPR)-containing, small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha, small glutamine-rich tetratricopeptide repeat-containing protein alpha, UBP, Vpu-binding protein | |
| SGTA | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6449 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto