missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPAG11B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-91448
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
SPAG11B Polyclonal specifically detects SPAG11B in Human samples. It is validated for Western Blot.
Specifica
| SPAG11B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EP2, sperm associated antigen 11B | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10407 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_478108 | |
| SPAG11B | |
| Synthetic peptide directed towards the N terminal of human SPAG11B. Peptide sequence MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG. | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto