missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. tescalcin Antibody - Azide and BSA Free, R&D Systems™

tescalcin Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18615490 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18615490 0.02 mL 0.02mL
18619920 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18615490 Proveedor Novus Biologicals N.º de proveedor NBP2938190.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Ver productos alternativos

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

tescalcin Polyclonal antibody specifically detects tescalcin in Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen tescalcin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias calcineurin B homologous protein 3, CHP3, TSC
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3). YRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Endocrinology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 54997
Target Species Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.