Abnova™ TTLL3 Recombinant Protein

Marca: Abnova™ H00026140-P01.10ug

Codice prodotto. 16128122

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Numero di accesso	AAH09479
Formulazione	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecolare	36.85
Intervallo di pH	8
Metodo di purificazione	Glutathione Sepharose 4 Fast Flow
Quantità	10 μg
Immunogeno	TEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDK
Alias gene	DKFZp434B103/DKFZp686D076/FLJ13898/HOTTL/MGC120529/MGC120530/MGC120532
Simbolo del gene	TTLL3
Specie	Wheat Germ (in vitro)
Tag proteine	GST

Da utilizzare con (applicazione)	Antibody Production, Protein Array, ELISA, Western Blot
ID gene (immissione)	26140
Nome	TTLL3 (Human) Recombinant Protein (P01)
Metodo di preparazione	In vitro wheat germ expression system
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Sorgente	Wheat Germ (in vitro)
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nome comune	TTLL3
Cross-reattività	Human
Recombinant	Recombinant
Forma	Solution

Suggerimenti di prodotto

Descrizione