missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XP32 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-93557
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
XP32 Polyclonal specifically detects XP32 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| XP32 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C1orf68, chromosome 1 open reading frame 68, LEP7, skin-specific protein (xp32), skin-specific protein 32, XP32 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 100129271 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C1orf68 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSG | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto