missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ZNF2 Recombinant Protein

Brand:  Abnova™ H00007549-P01.25ug

Additional Details : Peso : 0.00010kg

 View more versions of this product

Product Code. 16171942

  • 508.00€ / 25µg
Spedizione stimata: 26-08-2024
per visualizzare lo stock disponibile

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH05068
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
57.86
8
Glutathione Sepharose 4 Fast Flow
25 ug
MGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQECSDCGKTFFDHSSLTRHQRTHTGEKPYDCRECGKAFSHRSSLSRHLMSHTGESPYECSVCSKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHQRIHTGESPYECHQCGKAFSQKSILTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGDPRYQCNECGKAFFDRSSLTQHQKIHTGDKPHECSECGKAFSQRCRLTRHQRVHTGEKPFECTVCGKVFSSKSSVIQHQRRYAKQGID
A1-5/ZNF661/Zfp661
ZNF2
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
7549
ZNF2 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ZNF2
Human
Recombinant
Solution
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers