missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF778 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
582.00€
Specifica
| Antigene | ZNF778 |
|---|---|
| Applicazioni | Western Blot |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Forma | Purified |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18280736
|
Novus Biologicals
NBP1-80195 |
100 μL |
582.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
ZNF778 Polyclonal specifically detects ZNF778 in Human samples. It is validated for Western Blot.Specifica
| ZNF778 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_872337 | |
| 197320 | |
| Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA. | |
| Primary | |
| 49 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ31875, MGC150573, zinc finger protein 778 | |
| ZNF778 | |
| IgG | |
| Protein A purified |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto