All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (9)
- (28)
- (9)
- (2)
- (2)
- (58)
- (12)
- (32)
- (76)
- (3)
- (1)
- (128)
- (19)
- (1)
- (218)
- (17)
- (77)
- (166)
- (25)
- (3)
- (3)
- (1)
- (1)
- (120)
- (3)
- (77)
- (35)
- (1)
- (3)
- (2)
- (3)
- (7)
- (3)
- (16)
- (3)
- (1)
- (3)
- (2)
- (2)
- (2)
- (2)
- (1)
- (282)
- (110)
- (1)
- (2)
- (95)
- (84)
- (188)
- (11)
Risultati della ricerca filtrata
Invitrogen™ CLOCK Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ CLOCK Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ CLOCK Monoclonal Antibody (OTI2C3)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ CLOCK Recombinant Rabbit Monoclonal Antibody (3D8H6)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Recombinant Monoclonal Antibody
Invitrogen™ CLOCK Recombinant Rabbit Monoclonal Antibody (K01_4U14)
Rabbit Recombinant Monoclonal Antibody
Invitrogen™ CLOCK Recombinant Rabbit Monoclonal Antibody (JA12-33)
Rabbit Recombinant Monoclonal Antibody
| ID gene (immissione) | 9575 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogeno | This antibody was developed against Recombinant Protein corresponding to amino acids:TQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD |
| N. accesso geni | O15516 |
| Target Species | Human |
| Applicazioni | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
| Isotype | IgG |
| Test di specificità | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Antigene | CLOCK |
| Metodo di purificazione | Affinity Purified |
| Simboli geni | CLOCK |
| Status giuridico | RUO |
| Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Diluizione | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Primario o secondario | Primary |
| ID gene (immissione) | 9575 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Immunogeno | Two peptides derived from mouse CLOCK conjugated to albumin. [UniProt# O08785] |
| N. accesso geni | O08785 |
| Target Species | Human,Mouse |
| Applicazioni | Western Blot,ChIP Assay |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
| Isotype | IgG |
| Forma | Antisera |
| Antigene | CLOCK |
| Metodo di purificazione | Unpurified |
| Simboli geni | CLOCK |
| Status giuridico | RUO |
| Formulazione | Whole antisera with 0.05% Sodium Azide |
| Disciplina di ricerca | Chromatin Research, Circadian Rhythm, Neuroscience, Signal Transduction, Transcription Factors and Regulators |
| Diluizione | Western Blot 1:1000, Chromatin Immunoprecipitation (ChIP) 1:10-1:500 |
| Primario o secondario | Primary |
| ID gene (immissione) | 9575 |
|---|---|
| Specie ospite | Mouse |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunogeno | Purified recombinant fragment of human CLOCK expressed in E. Coli. |
| Target Species | Human |
| Applicazioni | Western Blot |
| Coniugato | Unconjugated |
| Peso molecolare dell'antigene | 95 kDa |
| Classificazione | Monoclonal |
| Alias gene | BHLHE8, circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, clock (mouse) homolog, clock homolog (mouse), EC 2.3.1.48, hCLOCK, KAT13D, KIAA0334bHLHe8circadian locomoter output cycles kaput protein |
| Isotype | IgG1 |
| Forma | Ascites |
| Antigene | CLOCK |
| Metodo di purificazione | Unpurified |
| Simboli geni | CLOCK |
| Status giuridico | RUO |
| Diluizione | Western Blot 1:500-1:2000, ELISA 1:10000, Immunocytochemistry/Immunofluorescence 1:200-1:1000 |
| Primario o secondario | Primary |
| Clone | 8F7 |
| ID gene (immissione) | 9575 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | -20°C |
| Immunogeno | CLOCK Fusion Protein Ag12826 |
| N. accesso geni | O15516 |
| Target Species | Human |
| Applicazioni | Immunocytochemistry,Immunofluorescence,Western Blot |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | bHLHe8, CLOCK, clock homolog (mouse), hCLOCK, KAT13D, KIAA0334 |
| Isotype | IgG |
| Forma | Liquid |
| Antigene | CLOCK |
| Gene | CLOCK |
| Product Type | Antibody |
| Metodo di purificazione | Antigen Affinity Chromatography |
| Simboli geni | CLOCK |
| Status giuridico | RUO |
| Formulazione | PBS with 50% glycerol and 0.1% sodium azide; pH 7.3 |
| Concentrazione | 0.13 mg/mL |
| Primario o secondario | Primary |
| ID gene (immissione) | 9575 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at -20°C. Stable for one year after shipment. |
| Target Species | Human,Mouse,Rat |
| Forma | Liquid |
| Applicazioni | Western Blot,Immunohistochemistry,ELISA |
| Antigene | CLOCK |
| Isotype | IgG |
| Simboli geni | bHLHe8, CLOCK, clock homolog (mouse), hCLOCK, KAT13D, KIAA0334 |
| Concentrazione | 800 μg/mL |
| Primario o secondario | Primary |
| Clone | 1I23 |