missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Acetyl-coenzyme A transporter 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-68761
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
Acetyl-coenzyme A transporter 1 Polyclonal antibody specifically detects Acetyl-coenzyme A transporter 1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifikationer
| Acetyl-coenzyme A transporter 1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| ACATNAcetyl-CoA transporter 1, acetyl-Coenzyme A transporter, AT-1acetyl-coenzyme A transporter 1, AT1SPG42, solute carrier family 33 (acetyl-CoA transporter), member 1, Solute carrier family 33 member 1, spastic paraplegia 42 (autosomal dominant) | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 9197 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering