missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AR (Human) Recombinant Protein

Human AR partial ORF ( NP_000035, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000367-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16161761

  • 302.00€ / 10µg


Spedizione stimata
23-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL
Specifica

Specifica

NP_000035
androgen receptor
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AR
GST
367
Wheat germ expression system
10 μg
AIS, DHTR, HUMARA, KD, NR3C4, SBMA, SMAX1, TFM
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documenti