missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aurora B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-55144-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Aurora B Polyclonal specifically detects Aurora B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifica
| Aurora B | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| AIK2EC 2.7.11.1, AIM1Aik2, AIM-1STK-1, ARK2ARK-2, AurB, aurkb-sv2, Aurora- and IPL1-like midbody-associated protein 1, aurora kinase BSerine/threonine-protein kinase aurora-B, aurora kinase B-Sv1, aurora kinase B-Sv2, Aurora/IPL1-related kinase 2, aurora-1, aurora-B, Aurora-related kinase 2, EC 2.7.11, IPL1, serine/threonine kinase 12, serine/threonine-protein kinase 12, STK12aurkb-sv1, STK5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| AURKB | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID | |
| 25 μL | |
| Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, DNA Repair, Mitotic Regulators, Stem Cell Markers | |
| 9212 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto