missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C-Reactive Protein/CRP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-87184-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
C-Reactive Protein/CRP Polyclonal specifically detects C-Reactive Protein/CRP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| C-Reactive Protein/CRP | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 | |
| C-reactive protein, C-reactive protein, pentraxin-related, MGC88244, pentraxin 1, PTX1MGC149895 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CRP | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS | |
| 25 μL | |
| Cancer, Cytokine Research, Immunology, Innate Immunity | |
| 1401 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto