missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C-Reactive Protein/CRP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 600.00€
Specifica
| Antigene | C-Reactive Protein/CRP |
|---|---|
| Diluizione | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applicazioni | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18454861
|
Novus Biologicals
NBP1-87184-25ul |
25 μL |
280.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18252848
|
Novus Biologicals
NBP1-87184 |
0.1 mL |
600.00€
0.10mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
C-Reactive Protein/CRP Polyclonal specifically detects C-Reactive Protein/CRP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifica
| C-Reactive Protein/CRP | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| C-reactive protein, C-reactive protein, pentraxin-related, MGC88244, pentraxin 1, PTX1MGC149895 | |
| CRP | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cytokine Research, Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1401 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto