missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ces2a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-91620
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Ces2a Polyclonal specifically detects Ces2a in Mouse samples. It is validated for Western Blot.
Specifica
| Ces2a | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| carboxylesterase 2A | |
| Rabbit | |
| 61 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_598721 | |
| CES6 | |
| Synthetic peptide directed towards the middle region of human CES6. Peptide sequence MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL. | |
| Protein A purified | |
| RUO | |
| 102022 | |
| Mouse, Rat | |
| Purified |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto