missing translation for 'onlineSavingsMsg'
Learn More
Learn More
cGAS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
Marca: Novus Biologicals NBP1-86761-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
cGAS Polyclonal specifically detects cGAS in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifica
| cGAS | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/mL, Simple Western 1:30, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin | |
| C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 115004 | |
| Human, Mouse | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MB21D1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto