missing translation for 'onlineSavingsMsg'
Learn More
Learn More
cGAS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
337.00€ - 686.00€
Specifica
| Antigene | cGAS |
|---|---|
| Applicazioni | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Specie ospite | Rabbit |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18444431
|
Novus Biologicals
NBP1-86761-25ul |
25 μL |
337.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18787343
|
Novus Biologicals
NBP1-86761 |
686.00€
0.10mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||||
Descrizione
cGAS Polyclonal specifically detects cGAS in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifica
| cGAS | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1 | |
| MB21D1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 115004 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto