missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ephrin-A1 Rabbit anti-Human, Mouse, Clone: 5D4Q5, Novus Biologicals™
Rabbit Monoclonal Antibody
Marca: Novus Biologicals NBP3-16761-20UL
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Ephrin-A1 Monoclonal antibody specifically detects Ephrin-A1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Specifica
| Ephrin-A1 | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 5D4Q5 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| ECKLG, EFL1, EPH-related receptor tyrosine kinase ligand 1, ephrin-A1, EPLG1TNF alpha-induced protein 4, Immediate early response protein B61, LERK1LERK-1, ligand of eph-related kinase 1, TNFAIP4B61, Tumor necrosis factor alpha-induced protein 4, tumor necrosis factor, alpha-induced protein 4 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin-A1 (P20827). MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHG | |
| 20 μg | |
| Cancer | |
| 1942 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto