missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ephrin-A1 Rabbit anti-Human, Mouse, Clone: 5D4Q5, Novus Biologicals™
Rabbit Monoclonal Antibody
262.00€ - 639.00€
Specifica
| Antigene | Ephrin-A1 |
|---|---|
| Clone | 5D4Q5 |
| Diluizione | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applicazioni | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classificazione | Monoclonal |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18391904
|
Novus Biologicals
NBP3-16761-20UL |
20 μg |
262.00€
20µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18359915
|
Novus Biologicals
NBP3-16761-100UL |
100 μg |
639.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
Ephrin-A1 Monoclonal antibody specifically detects Ephrin-A1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifica
| Ephrin-A1 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| ECKLG, EFL1, EPH-related receptor tyrosine kinase ligand 1, ephrin-A1, EPLG1TNF alpha-induced protein 4, Immediate early response protein B61, LERK1LERK-1, ligand of eph-related kinase 1, TNFAIP4B61, Tumor necrosis factor alpha-induced protein 4, tumor necrosis factor, alpha-induced protein 4 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin-A1 (P20827). MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 5D4Q5 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 1942 | |
| IgG | |
| Affinity purified |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto