missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FRAS1 Related Extracellular Matrix 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-30847
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
FRAS1 Related Extracellular Matrix 3 Polyclonal specifically detects FRAS1 Related Extracellular Matrix 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| FRAS1 Related Extracellular Matrix 3 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P0C091 | |
| FRAS1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QHDAFSLILSKDSYQWVVGNSIIEKVQVQVTVLPVDNVGPKVLVGESFIVYEGEKNSLTLQHLHVEDVDTHQDELLCTVTSQPA | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FRAS1-Related Extracellular Matrix Protein 3, FREM3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 166752 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto