missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FRAS1 Related Extracellular Matrix 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
337.00€ - 706.00€
Specifica
| Antigene | FRAS1 Related Extracellular Matrix 3 |
|---|---|
| Diluizione | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applicazioni | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18413172
|
Novus Biologicals
NBP2-30847-25ul |
25 μL |
337.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18196892
|
Novus Biologicals
NBP2-30847 |
0.1 mL |
706.00€
0.10mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
FRAS1 Related Extracellular Matrix 3 Polyclonal specifically detects FRAS1 Related Extracellular Matrix 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifica
| FRAS1 Related Extracellular Matrix 3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FRAS1-Related Extracellular Matrix Protein 3, FREM3 | |
| FRAS1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P0C091 | |
| 166752 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QHDAFSLILSKDSYQWVVGNSIIEKVQVQVTVLPVDNVGPKVLVGESFIVYEGEKNSLTLQHLHVEDVDTHQDELLCTVTSQPA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto