missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HADH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-54732
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
HADH Polyclonal specifically detects HADH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| HADH | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.1.1, EC 1.1.1.35, HADH1, HADHSChydroxyacyl-Coenzyme A dehydrogenase, HCDH, hydroxyacyl-CoA dehydrogenase, L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain, Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase, MGC8392, mitochondrial, MSCHAD, SCHADHHF4 | |
| Rabbit | |
| 33 kDa | |
| 100 μL | |
| Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers | |
| 3033 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Q16836 | |
| HADH | |
| Synthetic peptides corresponding to HADH(hydroxyacyl-Coenzyme A dehydrogenase) The peptide sequence was selected from the C terminal of HADH. Peptide sequence YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Yeast: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto