missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HADH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
559.00€
Specifica
| Antigene | HADH |
|---|---|
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Specie ospite | Rabbit |
| Status giuridico | RUO |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18267192
|
Novus Biologicals
NBP1-54732 |
100 μL |
559.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
HADH Polyclonal specifically detects HADH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifica
| HADH | |
| Unconjugated | |
| RUO | |
| Q16836 | |
| 3033 | |
| Synthetic peptides corresponding to HADH(hydroxyacyl-Coenzyme A dehydrogenase) The peptide sequence was selected from the C terminal of HADH. Peptide sequence YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers | |
| EC 1.1.1, EC 1.1.1.35, HADH1, HADHSChydroxyacyl-Coenzyme A dehydrogenase, HCDH, hydroxyacyl-CoA dehydrogenase, L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain, Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase, MGC8392, mitochondrial, MSCHAD, SCHADHHF4 | |
| HADH | |
| IgG | |
| 33 kDa |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto