missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HPCA (Human) Recombinant Protein

Human HPCA full-length ORF ( NP_002134, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00003208-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16159504

  • 458.00€ / 25µg


Spedizione stimata
20-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
Specifica

Specifica

NP_002134
hippocalcin
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HPCA
GST
3208
Wheat germ expression system
25 μg
BDR2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documenti