missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human APRT Full-length ORF (NP_000476.1, 1 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00000353-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16161731

  • 302.00€ / 10µg


Spedizione stimata
18-11-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Specifica

Specifica

NP_000476.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
APRT
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
353
APRT (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AMP|DKFZp686D13177|MGC125856|MGC125857|MGC129961
APRT
Yes
Videos
Documenti