missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ARPC5 Partial ORF (NP_005708.1, 3 a.a. - 94 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00010092-Q02.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. [provided by RefSeq]
Sequence: KNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKASpecifica
| NP_005708.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.86kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKA | |
| RUO | |
| ARPC5 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10092 | |
| ARPC5 (Human) Recombinant Protein (Q02) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ARC16/MGC88523/dJ127C7.3/p16-Arc | |
| ARPC5 | |
| Recombinant | |
| wheat germ expression system |