missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARTS-1 Partial ORF (AAH30775, 832 a.a. - 941 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00051752-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16127296

  • 508.00€ / 25µg
Spedizione stimata: 26-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

Aminopeptidases play a role in the metabolism of several peptides that may be involved in blood pressure and the pathogenesis of essential hypertension (MIM 145500). Adipocyte-derived leucine aminopeptidase (ALAP) is a member of the M1 family of zinc metallopeptidases.[supplied by OMIM]

Sequence: FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Specifica

Specifica

AAH30775
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
RUO
ERAP1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
51752
ARTS-1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
A-LAP/ALAP/APPILS/ARTS-1/ARTS1/ERAAP/ERAAP1/KIAA0525/PILS-AP/PILSAP
ERAP1
Recombinant
wheat germ expression system
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali