missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATF4 Partial ORF (NP_001666.2, 171 a.a. - 270 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000468-Q01.10ug

Additional Details : Peso : 0.00010kg

 View more versions of this product

Product Code. 16161991

  • 302.00€ / 10µg


Spedizione stimata
18-11-2020
Add to basket

Description

Description

Sequence: SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA
Specifications

Specifications

NP_001666.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA
RUO
ATF4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
468
ATF4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CREB-2|CREB2|TAXREB67|TXREB
ATF4
Yes
Videos
missing translation for 'documents'