Abnova™ Human C17orf37 Full-length ORF (NP_115715.3, 1 a.a. - 115 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00084299-P01.25ug

Codice prodotto. 16125803

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Sequence: MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

Specifica

Numero di accesso	NP_115715.3
Formulazione	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecolare	38.8kDa
Metodo di purificazione	Glutathione Sepharose 4 Fast Flow
Quantità	25 ug
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene	C35/MGC14832/ORB3/RDX12/XTP4
Simbolo del gene	C17orf37
Recombinant	Recombinant
Sistema di espressione	wheat germ expression system

Da utilizzare con (applicazione)	Antibody Production, Protein Array, ELISA, Western Blot
ID gene (immissione)	84299
Nome	C17orf37 (Human) Recombinant Protein (P01)
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogeno	MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Status giuridico	RUO
Nome comune	C17orf37
Specie	Wheat Germ (in vitro)
Tag proteine	GST
Forma	Liquid

Product Suggestions

Descrizione