missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human C1orf22 Full-length ORF (AAH16464.1, 1 a.a. - 122 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00080267-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Quality control in the endoplasmic reticulum (ER) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. EDEM3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the ER (Hirao et al., 2006 [PubMed 16431915]).[supplied by OMIM]
Sequence: MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCSTAPPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGSSPFLVLGVRGSFGKMHPSIVAFSpecifica
AAH16464.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
39.9kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C1orf22 | |
EDEM3 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
80267 | |
C1orf22 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MGGFKYGDEQPRSDWRSYRRNLEHAVLELTLFKTVPSKMEIHSSPFKCSTAPPCNTSGQGKITEHSCEPDFCCLWIDKKQNSFSSGVGNRSLDSLLIKGSSPFLVLGVRGSFGKMHPSIVAF | |
RUO | |
EDEM3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |