missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human COP1 Full-length ORF (NP_443121.1, 1 a.a. - 97 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00114769-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Sequence: MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGNSpecifica
NP_443121.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.1kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
COP/COP1/PSEUDO-ICE | |
CARD16 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
114769 | |
COP1 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN | |
RUO | |
CARD16 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |