Abnova™ Human DAPP1 Partial ORF (NP_055210, 1 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00027071-Q01.25ug

Codice prodotto. 16125676

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKH

Specifica

Numero di accesso	NP_055210
Formulazione	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecolare	37.4kDa
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogeno	MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKH
Status giuridico	RUO
Nome comune	DAPP1
Specie	Wheat Germ (in vitro)
Tag proteine	GST
Forma	Liquid

Da utilizzare con (applicazione)	Antibody Production, ELISA, Protein Array, Western Blot
ID gene (immissione)	27071
Nome	DAPP1 (Human) Recombinant Protein (Q01)
Quantità	25 μg
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene	BAM32/DKFZp667E0716
Simbolo del gene	DAPP1
Recombinant	Recombinant
Sistema di espressione	wheat germ expression system

Suggerimenti di prodotto

Descrizione