missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FOXG1 Partial ORF (CAA52241.1, 164 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
| Numero di accesso | CAA52241.1 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 2290 |
| Peso molecolare | 32.45kDa |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16043995
|
Abnova™
H00002290-Q03.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 06-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
|
16053995
|
Abnova™
H00002290-Q03.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 06-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon. [provided by RefSeq]
Sequence: SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGESpecifica
| CAA52241.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.45kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BF1/BF2/FHKL3/FKH2/FKHL1/FKHL2/FKHL3/FKHL4/FOXG1A/FOXG1B/FOXG1C/HBF-1/HBF-2/HBF-3/HBF-G2/HBF2/HFK1/HFK2/HFK3/KHL2/QIN | |
| FOXG1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 2290 | |
| FOXG1 (Human) Recombinant Protein (Q03) | |
| SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE | |
| RUO | |
| FOXG1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |