missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GATAD2B Partial ORF (NP_065750, 3 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00057459-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16132693

  • 508.00€ / 25µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

Sequence: RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR
Specifica

Specifica

NP_065750
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR
RUO
GATAD2B
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
57459
GATAD2B (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ37346/KIAA1150/MGC138257/MGC138285/P66beta/RP11-216N14.6
GATAD2B
Recombinant
wheat germ expression system
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali