missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LANCL1 Partial ORF (NP_006046, 1 a.a. - 58 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00010314-Q01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
Sequence: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDSpecifica
| NP_006046 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.12kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRD | |
| RUO | |
| LANCL1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10314 | |
| LANCL1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GPR69A/p40 | |
| LANCL1 | |
| Recombinant | |
| wheat germ expression system |