missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LRP1B Partial ORF (NP_061027, 111 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00053353-Q01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
LRP1B belongs to the low density lipoprotein (LDL) receptor gene family. These receptors play a wide variety of roles in normal cell function and development due to their interactions with multiple ligands (Liu et al., 2001 [PubMed 11384978]).[supplied by OMIM]
Sequence: VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPTSpecifica
| NP_061027 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.42kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT | |
| RUO | |
| LRP1B | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 53353 | |
| LRP1B (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| LRP-DIT/LRPDIT | |
| LRP1B | |
| Recombinant | |
| wheat germ expression system |