missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MTMR1 Full-length ORF (AAH11250, 1 a.a. - 38 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00008776-P01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq]
Sequence: MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAVSpecifica
| AAH11250 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 29.92kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MTMR1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 8776 | |
| MTMR1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV | |
| RUO | |
| MTMR1 | |
| Recombinant | |
| wheat germ expression system |