missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MUCDHL Partial ORF (NP_068743, 27 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00053841-Q01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motifs found in all cadherins. The role of the hybrid extracellular region and the specific function of this protein have not yet been determined. Alternative splicing has been identified, with observed variation resulting in the presence or absence of domains. In addition, splicing occurs in the 5' UTR but transcripts including these variations have not been described completely. [provided by RefSeq]
Sequence: AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFPSpecifica
| NP_068743 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP | |
| RUO | |
| MUPCDH | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 53841 | |
| MUCDHL (Human) Recombinant Protein (Q01) | |
| 25 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ20219/MU-PCDH/MUCDHL | |
| MUPCDH | |
| Recombinant | |
| wheat germ expression system |