Abnova™ Human NDRG3 Partial ORF (NP_114402.1, 277 a.a. - 375 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00057446-Q01.25ug

Product Code. 16129096

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

This item is not returnable. View return policy

Description

Sequence: LNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC

Specifications

Numero di accesso	NP_114402.1
Formulazione	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecolare	36.63kDa
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogeno	LNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC
Status giuridico	RUO
Nome comune	NDRG3
Specie	Wheat Germ (in vitro)
Tag proteine	GST
Forma	Liquid

Da utilizzare con (applicazione)	Antibody Production, ELISA, Protein Array, Western Blot
ID gene (immissione)	57446
Nome	NDRG3 (Human) Recombinant Protein (Q01)
Quantità	25 μg
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene	FLJ13556
Simbolo del gene	NDRG3
Recombinant	Recombinant
Sistema di espressione	wheat germ expression system

Product Suggestions

Description