missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NMNAT2 Partial ORF (NP_055854, 208 a.a. - 307 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00023057-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16126902

  • 349.00€ / 10µg
Spedizione stimata: 07-11-2023
per visualizzare lo stock disponibile

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!


Descrizione

Descrizione

This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG
Specifica

Specifica

NP_055854
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG
RUO
NMNAT2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
23057
NMNAT2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C1orf15/KIAA0479/MGC2756/PNAT-2/PNAT2
NMNAT2
Recombinant
wheat germ expression system
Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali