missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NRIP3 Full-length ORF (NP_065696.1, 1 a.a. - 241 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00056675-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16172253

  • 528.00€ / 25µg
Spedizione stimata: 07-11-2023
per visualizzare lo stock disponibile

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!


Descrizione

Descrizione

Sequence: MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSEA
Specifica

Specifica

NP_065696.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
53.4kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C11orf14/NY-SAR-105
NRIP3
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
56675
NRIP3 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSEA
RUO
NRIP3
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali