missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PBX2 Partial ORF (NP_002577, 354 a.a. - 430 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005089-Q02.25ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16064505

  • 458.00€ / 25µg


Spedizione stimata
21-10-2020
Aggiungi al carrello

Descrizione

Descrizione

Sequence: DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
Specifica

Specifica

NP_002577
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.21kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
RUO
PBX2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5089
PBX2 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
G17|HOX12|PBX2MHC
PBX2
Yes
Videos
Documenti