missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PF4 Partial ORF (NP_002610, 31 a.a. - 101 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00005196-Q01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM]
Sequence: AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLESSpecifica
| NP_002610 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.55kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES | |
| RUO | |
| PF4 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5196 | |
| PF4 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CXCL4/MGC138298/SCYB4 | |
| PF4 | |
| Recombinant | |
| wheat germ expression system |