missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PITPNA Full-length ORF (NP_006215.1, 1 a.a. - 270 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00005306-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase
Sequence: MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADDSpecifica
NP_006215.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
58.2kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC99649/PITPN/VIB1A | |
PITPNA | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
5306 | |
PITPNA (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD | |
RUO | |
PITPNA | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto