Learn More
Abnova™ Human PPP1CB Partial ORF (NP_002700, 231 a.a. - 327 a.a.) Recombinant Protein with GST-tag at N-terminal
Descrizione
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]
Specifica
Specifica
| Numero di accesso | NP_002700 |
| Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 5500 |
| Peso molecolare | 36.41kDa |
| Nome | PPP1CB (Human) Recombinant Protein (Q01) |
| Analisi di controllo qualità | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantità | 10 ug |
| Immunogeno | VSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR |
| Requisiti di stoccaggio | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Vedi altri risultati |
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.