missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PPP2R5A Partial ORF (NP_006234, 352 a.a. - 438 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00005525-Q01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. [provided by RefSeq]
Sequence: LFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKSpecifica
| NP_006234 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.31kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYK | |
| RUO | |
| PPP2R5A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5525 | |
| PPP2R5A (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| B56A/MGC131915/PR61A | |
| PPP2R5A | |
| Recombinant | |
| wheat germ expression system |