missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PPP2R5A Partial ORF (NP_006234, 352 a.a. - 438 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00005525-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16133215

  • 349.00€ / 10µg
Spedizione stimata: 07-11-2023
per visualizzare lo stock disponibile

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!


Descrizione

Descrizione

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. [provided by RefSeq]

Sequence: LFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYK
Specifica

Specifica

NP_006234
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.31kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYK
RUO
PPP2R5A
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
5525
PPP2R5A (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B56A/MGC131915/PR61A
PPP2R5A
Recombinant
wheat germ expression system
Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali