Abnova™ Human SLC13A4 Partial ORF (NP_036582.2, 166 a.a. - 274 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00026266-Q01.25ug

Product Code. 16125426

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

This item is not returnable. View return policy

Description

Sequence: LVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISY

Specifications

Numero di accesso	NP_036582.2
Formulazione	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecolare	37.73kDa
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogeno	LVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISY
Status giuridico	RUO
Nome comune	SLC13A4
Specie	Wheat Germ (in vitro)
Tag proteine	GST
Forma	Liquid

Da utilizzare con (applicazione)	Antibody Production, ELISA, Protein Array, Western Blot
ID gene (immissione)	26266
Nome	SLC13A4 (Human) Recombinant Protein (Q01)
Quantità	25 ug
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene	SUT-1/SUT1
Simbolo del gene	SLC13A4
Recombinant	Recombinant
Sistema di espressione	wheat germ expression system

Product Suggestions

Description