missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC19A2 Partial ORF (NP_008927.1, 209 a.a. - 285 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00010560-Q01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
This gene encodes the thiamin transporter protein. Mutations in this gene cause thiamin-responsive megaloblastic anemia syndrome (TRMA), which is an autosomal recessive disorder characterized by diabetes mellitus, megaloblastic anemia and sensorineural deafness. [provided by RefSeq]
Sequence: PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDSpecifica
| NP_008927.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.21kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND | |
| RUO | |
| SLC19A2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10560 | |
| SLC19A2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TC1/THT1/THTR1/TRMA | |
| SLC19A2 | |
| Recombinant | |
| wheat germ expression system |