missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC19A2 Partial ORF (NP_008927.1, 209 a.a. - 285 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010560-Q01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16125332

  • 528.00€ / 25µg
Spedizione stimata: 03-11-2023
per visualizzare lo stock disponibile

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!


Descrizione

Descrizione

This gene encodes the thiamin transporter protein. Mutations in this gene cause thiamin-responsive megaloblastic anemia syndrome (TRMA), which is an autosomal recessive disorder characterized by diabetes mellitus, megaloblastic anemia and sensorineural deafness. [provided by RefSeq]

Sequence: PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND
Specifica

Specifica

NP_008927.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.21kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND
RUO
SLC19A2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
10560
SLC19A2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TC1/THT1/THTR1/TRMA
SLC19A2
Recombinant
wheat germ expression system
Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali